Structure of PDB 4mgx Chain A Binding Site BS01

Receptor Information
>4mgx Chain A (length=181) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QKVRAWGPGLETGQVGKSADFVVEAIGTLGFSIEGPSQAKIECDDKGDGS
CDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILPAPPDCFPDKVKAFGP
GLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVIPNGDGT
FRCSYVPTKPIKHTIIISWGGVNVPKSPFRV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mgx A Novel Structural Unit in the N-terminal Region of Filamins.
Resolution3.16 Å
Binding residue
(original residue number in PDB)		T603 L604 G605 F606 S607 I608 E609 G610 S612 Q613 A614 I616
Binding residue
(residue number reindexed from 1)		T28 L29 G30 F31 S32 I33 E34 G35 S37 Q38 A39 I41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0051015 actin filament binding
Biological Process
GO:0030036 actin cytoskeleton organization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4mgx, PDBe:4mgx, PDBj:4mgx
PDBsum4mgx
PubMed24469451
UniProtQ14315|FLNC_HUMAN Filamin-C (Gene Name=FLNC)

[Back to BioLiP]