Structure of PDB 4mgt Chain A Binding Site BS01

Receptor Information

>4mgt Chain A (length=199) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MSWRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGK
WHSVPAKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFN
FVLINRYKDGSDHICEHRDDERELASPIASVSFGASRDFVFRHKDSPSRR
VAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILLG

Ligand information

>4mgt Chain B (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tcgacagtgagaca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4mgt The complex structures of ALKBH2 mutants cross-linked to dsDNA reveal the conformational swing of β-hairpin
Resolution	2.6 Å
Binding residue (original residue number in PDB)	R98 W105
Binding residue (residue number reindexed from 1)	R44 W51

Enzymatic activity

Enzyme Commision number

1.14.11.33: DNA oxidative demethylase.

Gene Ontology

	Biological Process
GO:0006281	DNA repair

View graph for
Biological Process

External links

PDB	RCSB:4mgt, PDBe:4mgt, PDBj:4mgt
PDBsum	4mgt
PubMed
UniProt	Q6NS38\|ALKB2_HUMAN DNA oxidative demethylase ALKBH2 (Gene Name=ALKBH2)

[Back to BioLiP]