Structure of PDB 4mg2 Chain A Binding Site BS01

Receptor Information

>4mg2 Chain A (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MSWRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVAGK
WHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFN
FVLINRYKDGSDHICEHRDDERELASPIASVSFGASRDFVFRHKDSVAVV
RLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILLM

Ligand information

>4mg2 Chain C (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgtctcactgtcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4mg2 The complex structures of ALKBH2 mutants cross-linked to dsDNA reveal the conformational swing of β-hairpin
Resolution	2.3 Å
Binding residue (original residue number in PDB)	R98 C169 R198 R241 K242
Binding residue (residue number reindexed from 1)	R44 C115 R142 R177 K178

Enzymatic activity

Enzyme Commision number

1.14.11.33: DNA oxidative demethylase.

Gene Ontology

	Biological Process
GO:0006281	DNA repair

View graph for
Biological Process

External links

PDB	RCSB:4mg2, PDBe:4mg2, PDBj:4mg2
PDBsum	4mg2
PubMed
UniProt	Q6NS38\|ALKB2_HUMAN DNA oxidative demethylase ALKBH2 (Gene Name=ALKBH2)

[Back to BioLiP]