Structure of PDB 4mdr Chain A Binding Site BS01

Receptor Information
>4mdr Chain A (length=245) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NEVFLAVVERLSVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEF
SVGKSELRGYGPGIRVDEVSFHSSVNLDEFESHRILRLQPPQGELTVMRY
QLSDDLPSPLPFRLFPSVQWDRGSGRLQVYLKLRCDLLSKSQALNVRLHL
PLPRGVVSLSQELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPL
GLGPASLSFELPRHTCSGLQVRFLRLAPHKWVRHLSHSDAYVIRI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mdr Structural and Functional Characterization of Cargo-Binding Sites on the mu 4-Subunit of Adaptor Protein Complex 4.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		S254 F255 H256 S257 L261 E265 T280 R283
Binding residue
(residue number reindexed from 1)		S70 F71 H72 S73 L77 E81 T96 R99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006886 intracellular protein transport
GO:0016192 vesicle-mediated transport
Cellular Component
GO:0030131 clathrin adaptor complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4mdr, PDBe:4mdr, PDBj:4mdr
PDBsum4mdr
PubMed24498434
UniProtO00189|AP4M1_HUMAN AP-4 complex subunit mu-1 (Gene Name=AP4M1)

[Back to BioLiP]