Structure of PDB 4mdf Chain A Binding Site BS01

Receptor Information
>4mdf Chain A (length=171) Species: 203119 (Acetivibrio thermocellus ATCC 27405) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSNFCRGLVSDDEN
DQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHC
FPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGF
RYVYILNSPEEVEEVVFERQP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mdf Structures of bacterial polynucleotide kinase in a Michaelis complex with GTP*Mg2+ and 5'-OH oligonucleotide and a product complex with GDP*Mg2+ and 5'-PO4 oligonucleotide reveal a mechanism of general acid-base catalysis and the determinants of phosphoacceptor recognition.
Resolution1.727 Å
Binding residue
(original residue number in PDB)		S37 N38 R41 Q51 T54 F58 T80 Q83 R123 Y128 V129 H133
Binding residue
(residue number reindexed from 1)		S38 N39 R42 Q52 T55 F59 T81 Q84 R124 Y129 V130 H134
Enzymatic activity
Enzyme Commision number ?
External links