Structure of PDB 4m9e Chain A Binding Site BS01

Receptor Information
>4m9e Chain A (length=85) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
THTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELT
RHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4m9e Structural basis for Klf4 recognition of methylated DNA.
Resolution1.851 Å
Binding residue
(original residue number in PDB)
Y411 K413 H416 R443 E446 R449 R471 H474
Binding residue
(residue number reindexed from 1)
Y13 K15 H18 R45 E48 R51 R73 H76
Binding affinityPDBbind-CN: Kd=30nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4m9e, PDBe:4m9e, PDBj:4m9e
PDBsum4m9e
PubMed24520114
UniProtQ60793|KLF4_MOUSE Krueppel-like factor 4 (Gene Name=Klf4)

[Back to BioLiP]