Structure of PDB 4m6b Chain A Binding Site BS01

Receptor Information
>4m6b Chain A (length=185) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAY
NKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQAQSSSAR
AGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNA
AKDLKVKRITPRHLQLAIRGDDELDSLIRATIASG
Ligand information
>4m6b Chain C (length=23) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SVGLSALFDLDLDDSEDFTVNSS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4m6b The Catalytic Subunit of the SWR1 Remodeler Is a Histone Chaperone for the H2A.Z-H2B Dimer.
Resolution1.78 Å
Binding residue
(original residue number in PDB)		S41 Y45 I57 S58 Q59 K60 M62 S63 I64 S67 R194 P197 Q201 R205 R215 I218
Binding residue
(residue number reindexed from 1)		S5 Y9 I21 S22 Q23 K24 M26 S27 I28 S31 R158 P161 Q165 R169 R179 I182
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4m6b, PDBe:4m6b, PDBj:4m6b
PDBsum4m6b
PubMed24507717
UniProtP02293|H2B1_YEAST Histone H2B.1 (Gene Name=HTB1);
Q12692

[Back to BioLiP]