Structure of PDB 4m5s Chain A Binding Site BS01

Receptor Information
>4m5s Chain A (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISR
EFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4m5s The structured core domain of alpha B-crystallin can prevent amyloid fibrillation and associated toxicity.
Resolution1.37 Å
Binding residue
(original residue number in PDB)		V91 K92 V93 L94 L131 I133 S135 S136 L137 S138
Binding residue
(residue number reindexed from 1)		V25 K26 V27 L28 L65 I67 S69 S70 L71 S72
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4m5s, PDBe:4m5s, PDBj:4m5s
PDBsum4m5s
PubMed24711386
UniProtP02511|CRYAB_HUMAN Alpha-crystallin B chain (Gene Name=CRYAB)

[Back to BioLiP]