Structure of PDB 4m30 Chain A Binding Site BS01

Receptor Information
>4m30 Chain A (length=220) Species: 224324 (Aquifex aeolicus VF5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFI
VDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKIN
ETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKD
YKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKS
KKEAEQRAAEELIKLLEESE
Ligand information
>4m30 Chain C (length=27) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaggucauucgcaagaguggccuuuau
<<<<<<<<<<....>>>>>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4m30 RNase III: Genetics and Function; Structure and Mechanism.
Resolution2.501 Å
Binding residue
(original residue number in PDB)		H27 V28 R97 N101 T103 H179 H180 F184 S201 K202
Binding residue
(residue number reindexed from 1)		H26 V27 R96 N100 T102 H178 H179 F183 S200 K201
Enzymatic activity
Enzyme Commision number 3.1.26.3: ribonuclease III.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003725 double-stranded RNA binding
GO:0004519 endonuclease activity
GO:0004525 ribonuclease III activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0006397 mRNA processing
GO:0008033 tRNA processing
GO:0010468 regulation of gene expression
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4m30, PDBe:4m30, PDBj:4m30
PDBsum4m30
PubMed24274754
UniProtO67082|RNC_AQUAE Ribonuclease 3 (Gene Name=rnc)

[Back to BioLiP]