Structure of PDB 4lzf Chain A Binding Site BS01

Receptor Information
>4lzf Chain A (length=155) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGRLVVFPNGTRKELSADGQTVKVMFFNGDVKHTMPDQRVIYYYAEAQTT
HITYPDGMEVLQFPNNQTEKHFPDGRKEITFPDQTVKTLHPDGREESVLT
DGTIIQLNPDGSKVIQFNTGQREIHTADFKRREYPDGTVKTVYSDGRQET
QYPTG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lzf Structural analysis of the G-box domain of the microcephaly protein CPAP suggests a role in centriole architecture.
Resolution1.72 Å
Binding residue
(original residue number in PDB)		F959 P960 N961 T963 K965 F978 F979 N980 Y994 Y996
Binding residue
(residue number reindexed from 1)		F7 P8 N9 T11 K13 F26 F27 N28 Y42 Y44
Enzymatic activity
Enzyme Commision number ?
External links