Structure of PDB 4lvj Chain A Binding Site BS01

Receptor Information

>4lvj Chain A (length=192) Species: 1311 (Streptococcus agalactiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SYMVARMQKMKAGNLGGAFKHNERVFSNKDINPSRSHLNYELTDRDRSVS
YEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFF
ETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDR
EELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAM

Ligand information

>4lvj Chain B (length=7) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

actttat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4lvj Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
Resolution	2.17 Å
Binding residue (original residue number in PDB)	R71 A72 R74 K75 D76 K149
Binding residue (residue number reindexed from 1)	R67 A68 R70 K71 D72 K145

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0006310	DNA recombination

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4lvj, PDBe:4lvj, PDBj:4lvj
PDBsum	4lvj
PubMed	28739894
UniProt	P13925\|PRE_STRAG Plasmid recombination enzyme (Gene Name=pre)

[Back to BioLiP]