Structure of PDB 4lvi Chain A Binding Site BS01

Receptor Information
>4lvi Chain A (length=190) Species: 1311 (Streptococcus agalactiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYMVARMQKMKAGNLGGAFKHNERVSNKDINPSRSHLNYELTDRDRSVSY
EKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFE
TAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDRE
ELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lvi Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R71 A72 R74 K75 D76
Binding residue
(residue number reindexed from 1)		R66 A67 R69 K70 D71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4lvi, PDBe:4lvi, PDBj:4lvi
PDBsum4lvi
PubMed28739894
UniProtP13925|PRE_STRAG Plasmid recombination enzyme (Gene Name=pre)

[Back to BioLiP]