Structure of PDB 4lup Chain A Binding Site BS01

Receptor Information
>4lup Chain A (length=91) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAF
IKAYRALDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRLEL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lup Structural basis for -10 promoter element melting by environmentally induced sigma factors.
Resolution1.2 Å
Binding residue
(original residue number in PDB)		K56 F64 R65 D67 S68 A69 T72 W73 Y75 R76 I77 N80
Binding residue
(residue number reindexed from 1)		K52 F60 R61 D63 S64 A65 T68 W69 Y71 R72 I73 N76
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4lup, PDBe:4lup, PDBj:4lup
PDBsum4lup
PubMed24531660
UniProtQ0P6M2

[Back to BioLiP]