Structure of PDB 4lom Chain A Binding Site BS01

Receptor Information
>4lom Chain A (length=191) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFD
LTVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDE
TLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAA
NARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRV
Ligand information
Ligand IDIYP
InChIInChI=1S/C6H11N2O6P/c9-5(2-14-15(11,12)13)6(10)4-1-7-3-8-4/h1,3,5-6,9-10H,2H2,(H,7,8)(H2,11,12,13)/t5-,6+/m1/s1
InChIKeyHFYBTHCYPKEDQQ-RITPCOANSA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 1.7.6c1c([nH]cn1)C(C(COP(=O)(O)O)O)O
CACTVS 3.370O[C@H](CO[P](O)(O)=O)[C@@H](O)c1[nH]cnc1
OpenEye OEToolkits 1.7.6c1c([nH]cn1)[C@@H]([C@@H](COP(=O)(O)O)O)O
CACTVS 3.370O[CH](CO[P](O)(O)=O)[CH](O)c1[nH]cnc1
ACDLabs 12.01O=P(O)(O)OCC(O)C(O)c1cncn1
FormulaC6 H11 N2 O6 P
Name(2R,3S)-2,3-dihydroxy-3-(1H-imidazol-5-yl)propyl dihydrogen phosphate
ChEMBL
DrugBank
ZINC
PDB chain4lom Chain A Residue 301 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lom Crystal structures of the native, substrate- bound and inhibited forms of Mycobacterium tuberculosis imidazole glycerol phosphate dehydratase
Resolution2.1 Å
Binding residue
(original residue number in PDB)		H47 M107 H176 H177 E180 K184
Binding residue
(residue number reindexed from 1)		H38 M98 H167 H168 E171 K175
Annotation score5
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 18:41:26 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4lom', asym_id = 'A', bs = 'BS01', title = 'Crystal structures of the native, substrate- bo...ulosis imidazole glycerol phosphate dehydratase '
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4lom', asym_id='A', bs='BS01', title='Crystal structures of the native, substrate- bo...ulosis imidazole glycerol phosphate dehydratase ')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0000105,0004424', uniprot = '', pdbid = '4lom', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000105,0004424', uniprot='', pdbid='4lom', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>