Structure of PDB 4lnp Chain A Binding Site BS01

Receptor Information
>4lnp Chain A (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFP
RTYIELLPPAE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lnp Structural investigation of the interaction between the tandem SH3 domains of c-Cbl-associated protein and vinculin
Resolution1.41 Å
Binding residue
(original residue number in PDB)		F802 F804 K805 Q807 D827 N829 W830 Y846
Binding residue
(residue number reindexed from 1)		F9 F11 K12 Q14 D34 N36 W37 Y53
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4lnp, PDBe:4lnp, PDBj:4lnp
PDBsum4lnp
PubMed24878663
UniProtQ9BX66|SRBS1_HUMAN Sorbin and SH3 domain-containing protein 1 (Gene Name=SORBS1)

[Back to BioLiP]