Structure of PDB 4ln2 Chain A Binding Site BS01

Receptor Information
>4ln2 Chain A (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSR
QGIFPITYVDVIKRPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ln2 Structural investigation of the interaction between the tandem SH3 domains of c-Cbl-associated protein and vinculin
Resolution1.0 Å
Binding residue
(original residue number in PDB)		F876 E885 V900 D901 N903 W904 I917 P919 Y922
Binding residue
(residue number reindexed from 1)		F12 E21 V36 D37 N39 W40 I53 P55 Y58
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4ln2, PDBe:4ln2, PDBj:4ln2
PDBsum4ln2
PubMed24878663
UniProtQ9BX66|SRBS1_HUMAN Sorbin and SH3 domain-containing protein 1 (Gene Name=SORBS1)

[Back to BioLiP]