Structure of PDB 4lmz Chain A Binding Site BS01

Receptor Information
>4lmz Chain A (length=176) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPDAIKMFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGC
CFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLF
IGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMA
QNAIKAMHQSQTMEGCSSPIVVKFAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lmz sequence specific RNA recognition of ETR3 RRM 1-2 domains
Resolution2.78 Å
Binding residue
(original residue number in PDB)		F100 G102 M103 R137 C139 F141 S167 V171 K173 D176
Binding residue
(residue number reindexed from 1)		F100 G102 M103 R137 C139 F141 S167 V171 K173 D176
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Cellular Component
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4lmz, PDBe:4lmz, PDBj:4lmz
PDBsum4lmz
PubMed
UniProtO95319|CELF2_HUMAN CUGBP Elav-like family member 2 (Gene Name=CELF2)

[Back to BioLiP]