Structure of PDB 4lmg Chain A Binding Site BS01

Receptor Information
>4lmg Chain A (length=120) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LIHLDPVPSFEDRHEIKPWLQKIFYPQGIDIVIERSDSSKVTFKCRSVAC
PFRIRAAYSVRLQKWNVVVMNNIHSHELRFDLITKTDDYKKFKENLRQKN
DEKAIKTFDELEYKASLNLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lmg Molecular mechanism and structure of the Saccharomyces cerevisiae iron regulator Aft2.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		Q157 N159
Binding residue
(residue number reindexed from 1)		Q98 N100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
Biological Process
GO:0010106 cellular response to iron ion starvation
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4lmg, PDBe:4lmg, PDBj:4lmg
PDBsum4lmg
PubMed24591629
UniProtQ08957|AFT2_YEAST Iron-regulated transcriptional activator AFT2 (Gene Name=AFT2)

[Back to BioLiP]