Structure of PDB 4lll Chain A Binding Site BS01

Receptor Information
>4lll Chain A (length=138) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQN
DIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLV
EAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lll Structural mechanism of transcription regulation of the Staphylococcus aureus multidrug efflux operon mepRA by the MarR family repressor MepR.
Resolution3.036 Å
Binding residue
(original residue number in PDB)		H14 Q50 N51 P62 S65 R87 K89
Binding residue
(residue number reindexed from 1)		H13 Q49 N50 P61 S64 R86 K88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4lll, PDBe:4lll, PDBj:4lll
PDBsum4lll
PubMed24293644
UniProtQ5Y812

[Back to BioLiP]