Structure of PDB 4lkx Chain A Binding Site BS01

Receptor Information
>4lkx Chain A (length=214) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQESGPGLVKPSETLSLTCTVSGYSITSDYAWNWIRQPPGKGLEWIG
SISYSGITGYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCARMG
YDGLAYWGQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVT
VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHK
PSNTKVDKKAEPKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lkx Two potential therapeutic antibodies bind to a peptide segment of membrane-bound IgE in different conformations.
Resolution1.92 Å
Binding residue
(original residue number in PDB)
S31 D32 Y33 Y53 M95 G96 Y97
Binding residue
(residue number reindexed from 1)
S31 D32 Y33 Y54 M99 G100 Y101
Enzymatic activity
Enzyme Commision number ?
External links