Structure of PDB 4lk9 Chain A Binding Site BS01

Receptor Information
>4lk9 Chain A (length=126) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMLELPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHP
SCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFH
MECCDPPLTRMPKGMWICQICRPRKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lk9 The double PHD finger domain of MOZ/MYST3 induces alpha-helical structure of the histone H3 tail to facilitate acetylation and methylation sampling and modification.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
F211 L242 K243 I260 E261 A275 D276 M278 L279 F280 C281 D282 D285 M300 G303
Binding residue
(residue number reindexed from 1)
F22 L53 K54 I71 E72 A86 D87 M89 L90 F91 C92 D93 D96 M111 G114
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
External links
PDB RCSB:4lk9, PDBe:4lk9, PDBj:4lk9
PDBsum4lk9
PubMed24150941
UniProtQ92794|KAT6A_HUMAN Histone acetyltransferase KAT6A (Gene Name=KAT6A)

[Back to BioLiP]