Structure of PDB 4lj0 Chain A Binding Site BS01

Receptor Information
>4lj0 Chain A (length=65) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQDCKYWPNCANPLCAFRHPTMPPCRNGGECKVPGCKFTHLKTPCKFRPC
TNRSCPFLHEEGQRG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lj0 Structural basis for the molecular recognition of polyadenosine RNA by Nab2 Zn fingers.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		Y407 N410 C411 A412
Binding residue
(residue number reindexed from 1)		Y6 N9 C10 A11
Binding affinityPDBbind-CN: Kd=0.5uM
Enzymatic activity
Enzyme Commision number ?
External links