Structure of PDB 4lg7 Chain A Binding Site BS01

Receptor Information
>4lg7 Chain A (length=63) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKSVPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRSKSSLANYLHKNG
ETSLKPEDFDFTV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lg7 Crystal structure MBD4 MBD domain in complex with methylated CpG DNA
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R119 S120 K121 S122
Binding residue
(residue number reindexed from 1)		R37 S38 K39 S40
Enzymatic activity
Enzyme Commision number 3.2.2.-
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4lg7, PDBe:4lg7, PDBj:4lg7
PDBsum4lg7
PubMed
UniProtO95243|MBD4_HUMAN Methyl-CpG-binding domain protein 4 (Gene Name=MBD4)

[Back to BioLiP]