Structure of PDB 4lg6 Chain A Binding Site BS01

Receptor Information
>4lg6 Chain A (length=163) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ANSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAV
VEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWN
GGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQ
QVIESHLLKLLQN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lg6 Ankyrin Repeats of ANKRA2 Recognize a PxLPxL Motif on the 3M Syndrome Protein CCDC8.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
F183 W188 A191 Y254 H257 S280 Y282 A290
Binding residue
(residue number reindexed from 1)
F36 W41 A44 Y107 H110 S133 Y135 A143
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4lg6, PDBe:4lg6, PDBj:4lg6
PDBsum4lg6
PubMed25752541
UniProtQ9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 (Gene Name=ANKRA2)

[Back to BioLiP]