Structure of PDB 4lg0 Chain A Binding Site BS01

Receptor Information
>4lg0 Chain A (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNS
SAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lg0 Structure of a ternary FOXO1-ETS1 DNA complex
Resolution2.19 Å
Binding residue
(original residue number in PDB)		L183 S205 R214 H215 S218 R225 S235 W237
Binding residue
(residue number reindexed from 1)		L28 S50 R59 H60 S63 R70 S80 W82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4lg0, PDBe:4lg0, PDBj:4lg0
PDBsum4lg0
PubMed
UniProtQ12778|FOXO1_HUMAN Forkhead box protein O1 (Gene Name=FOXO1)

[Back to BioLiP]