Structure of PDB 4leb Chain A Binding Site BS01

Receptor Information

>4leb Chain A (length=299) Species: 5476 (Candida albicans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GKTITGVFNSFNSLTWSNAATYNYKGPGTPTWNAVLGWSLDGTSASPGDT
FTLNMPCVFKFTTSQTSVDLTAHGVKYATCQFQAGEEFMTFSTLTCTVSN
TLTPSIKALGTVTLPLAFNVGGTGSSVDLEDSKCFTAGTNTVTFNDGGKK
ISINVDFERSNVDPKGYLTDSRVIPSLNKVSTLFVAPQCANGYTSGTMGF
ANTYGDVQIDCSNIHVGITKGLNDWNYPVSSESFSYTKTCSSNGIFITYK
NVPAGYRPFVDAYISATDVNSYTLSYANEYTCAGGYWQRAPFTLRWTGY

Ligand information

>4leb Chain B (length=7) Species: 5476 (Candida albicans) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TTTTTTT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4leb The Peptide-binding Cavity Is Essential for Als3-mediated Adhesion of Candida albicans to Human Cells.
Resolution	1.4 Å
Binding residue (original residue number in PDB)	Y21 K59 S170 R171 V172 R294 W295 T296
Binding residue (residue number reindexed from 1)	Y22 K60 S171 R172 V173 R295 W296 T297

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0007155	cell adhesion

View graph for
Biological Process

External links

PDB	RCSB:4leb, PDBe:4leb, PDBj:4leb
PDBsum	4leb
PubMed	24802757
UniProt	Q59L12\|ALS3_CANAL Agglutinin-like protein 3 (Gene Name=ALS3)

[Back to BioLiP]