Structure of PDB 4ld3 Chain A Binding Site BS01

Receptor Information

>4ld3 Chain A (length=154) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GGRLVVFPNGTRKELSADGQTVKVMFFNGDVKHTMPDQRVIYYYAEAQTT
HITYPDGMEVLQFPNNQTEKHFPDGRKEITFPDQTVKTLHPDGREESVLT
DGTIIQLNPDGSKVIQFNTGQREIHTADFKRREYPDGTVKTVYSDGRQET
QYPT

Ligand information

>4ld3 Chain B (length=16) Species: 7955 (Danio rerio) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EDLSPRPSPNPHPVSQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4ld3 Structural analysis of the G-box domain of the microcephaly protein CPAP suggests a role in centriole architecture.
Resolution	2.44 Å
Binding residue (original residue number in PDB)	F959 F978 F979 N980 Y994 Y996 T1001 H1003 F1015 E1021 K1029 F1033 K1039
Binding residue (residue number reindexed from 1)	F7 F26 F27 N28 Y42 Y44 T49 H51 F63 E69 K77 F81 K87

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:4ld3, PDBe:4ld3, PDBj:4ld3
PDBsum	4ld3
PubMed	24076405
UniProt	E7FCY1

[Back to BioLiP]