Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP

Structure of PDB 4ld0 Chain A Binding Site BS01

Receptor Information
>4ld0 Chain A (length=158) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVVAGIDPGITHLGLGVVAVEGALKARLLHGEVVKTSPQEPAKERVGRIH
ARVLEVLHRFRPEAVAVQEQFFYRQNELAYKVGWALGAVLVAAFEAGVPV
YAYGPMQVKQALAKEEVALMVRGILGLKEAPRPSHLADALAIALTHAFYA
RMGTAKPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ld0 Crystal structure of RuvC resolvase in complex with Holliday junction substrate.
Resolution3.75 Å
Binding residue
(original residue number in PDB)		I10 T11 P40 R47 Q72 F73 F74 L80 M108
Binding residue
(residue number reindexed from 1)		I10 T11 P38 R45 Q70 F71 F72 L78 M106
Enzymatic activity
Enzyme Commision number 3.1.21.10: crossover junction endodeoxyribonuclease.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0004520 DNA endonuclease activity
GO:0008821 crossover junction DNA endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
GO:0006310 DNA recombination
Cellular Component
GO:0005737 cytoplasm
GO:0048476 Holliday junction resolvase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ld0, PDBe:4ld0, PDBj:4ld0
PDBsum4ld0
PubMed23980027
UniProtQ5SJC4|RUVC_THET8 Crossover junction endodeoxyribonuclease RuvC (Gene Name=ruvC)

[Back to BioLiP]

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417