Structure of PDB 4lck Chain A Binding Site BS01

Receptor Information
>4lck Chain A (length=81) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSVVSLAED
QGISVSMVESMKKLGKACGIEVGAAAVAIIL
Ligand information
>4lck Chain C (length=102) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggugcgaugagaagaagaguauuaaggauuuacuaugauuagcgacucu
aggauagugaaagcuagaggauaguaaccuuaagaaggcacuucgagcac
cc
<<<<<<.....<<<<.......<<<<<<..<<<<<<<.........<<<<
<<...........>>>>>>.>>>>>>>>>>>>>.......>>>>..>>>>
>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lck Co-crystal structure of a T-box riboswitch stem I domain in complex with its cognate tRNA.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		I14 G15 T16 K17 Q18 M62 V73 A75 A76
Binding residue
(residue number reindexed from 1)		I13 G14 T15 K16 Q17 M61 V72 A74 A75
Binding affinityPDBbind-CN: Kd=83nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4lck, PDBe:4lck, PDBj:4lck
PDBsum4lck
PubMed23892783
UniProtP46350|RXL7_BACSU RNA-binding protein YbxF (Gene Name=rulS)

[Back to BioLiP]