Structure of PDB 4l67 Chain A Binding Site BS01

Receptor Information

>4l67 Chain A (length=290) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAV
KKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLE
GGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLT
HDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIW
SLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFL
DRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNR

Ligand information

>4l67 Chain B (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

WQSLIEESARRPKPLVDPAC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4l67 NMR binding and crystal structure reveal that intrinsically-unstructured regulatory domain auto-inhibits PAK4 by a mechanism different for that of PAK1
Resolution	2.8 Å
Binding residue (original residue number in PDB)	K326 I327 E329 Q358 R359 D444 F461 L475 V476 G477 Y480 W481
Binding residue (residue number reindexed from 1)	K27 I28 E30 Q59 R60 D145 F162 L176 V177 G178 Y181 W182

Enzymatic activity

Catalytic site (original residue number in PDB)	D440 K442 D444 S445 D458 K467 T478
Catalytic site (residue number reindexed from 1)	D141 K143 D145 S146 D159 K168 T179
Enzyme Commision number	2.7.11.1: non-specific serine/threonine protein kinase.

Gene Ontology

	Molecular Function
GO:0004672	protein kinase activity
GO:0005524	ATP binding

	Biological Process
GO:0006468	protein phosphorylation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4l67, PDBe:4l67, PDBj:4l67
PDBsum	4l67
PubMed	23876315
UniProt	O96013\|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 (Gene Name=PAK4)

[Back to BioLiP]