Structure of PDB 4l5s Chain A Binding Site BS01

Receptor Information
>4l5s Chain A (length=199) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESKYY
RVKVFNMDLKEKFTENQFITISKYFNSSGILEINETATVSEAAPNQMFEV
PKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNE
DNIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKGE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4l5s Molecular Mechanism for p202-Mediated Specific Inhibition of AIM2 Inflammasome Activation.
Resolution2.94 Å
Binding residue
(original residue number in PDB)		K180 N182 D183 K184 S185 K198
Binding residue
(residue number reindexed from 1)		K136 N138 D139 K140 S141 K154
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002218 activation of innate immune response
GO:0035458 cellular response to interferon-beta

View graph for
Biological Process
External links
PDB RCSB:4l5s, PDBe:4l5s, PDBj:4l5s
PDBsum4l5s
PubMed23850291
UniProtQ9R002|IFI2_MOUSE Interferon-activable protein 202 (Gene Name=Ifi202)

[Back to BioLiP]