Structure of PDB 4kr6 Chain A Binding Site BS01

Receptor Information
>4kr6 Chain A (length=388) Species: 243274 (Thermotoga maritima MSB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEELRVYIVRYSEIGLKGKNRKDFEEALRRNIERVTGMKVKRQWGRFLIP
IDENVTLDDKLKKIFGIQNFSKGFLVSHDFEEVKKYSLIAVKEKLEKGNY
RTFKVQAKKAYKEYKKGVYEINSELGALILKNFKELSVDVRNPDFVLGVE
VRPEGVLIFTDRVECYGGLPVGTGGKAVLLLSGGIDSPVAGWYALKRGVL
IESVTFVSPPFTSEGAVEKVRDILRVLREFSGGHPLRLHIVNLTKLQLEV
KKRVPDKYSLIMYRRSMFRIAEKIAEETGAVAFYTGENIGQVASQTLENL
WSIESVTTRPVIRPLSGFDKTEIVEKAKEIGTYEISIKPYQDSCVFFAPK
NPATRSHPSILEKLEQQVPDLPVLEEEAFTSRKVEVIE
Ligand information
>4kr6 Chain D (length=39) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccggauaguguccuugggaaaccaaguccgggcacca
<<<<<<<<.........<<....>>..>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4kr6 Crystal structure of a 4-thiouridine synthetase-RNA complex reveals specificity of tRNA U8 modification.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		S12 E13 K17 K19 N20 R21 K22 R42 K104 V105 Q106 A107 K108 Y119 N122 S123 G126 A127 V138 V140 R141
Binding residue
(residue number reindexed from 1)		S12 E13 K17 K19 N20 R21 K22 R42 K104 V105 Q106 A107 K108 Y119 N122 S123 G126 A127 V138 V140 R141
Enzymatic activity
Enzyme Commision number 2.8.1.4: tRNA uracil 4-sulfurtransferase.
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0004810 CCA tRNA nucleotidyltransferase activity
GO:0005524 ATP binding
GO:0016740 transferase activity
GO:0016783 sulfurtransferase activity
GO:0140741 tRNA-uracil-4 sulfurtransferase activity
Biological Process
GO:0002937 tRNA 4-thiouridine biosynthesis
GO:0009228 thiamine biosynthetic process
GO:0009229 thiamine diphosphate biosynthetic process
GO:0034227 tRNA thio-modification
GO:0052837 thiazole biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4kr6, PDBe:4kr6, PDBj:4kr6
PDBsum4kr6
PubMed24705700
UniProtQ9X220|THII_THEMA Probable tRNA sulfurtransferase (Gene Name=thiI)

[Back to BioLiP]