Structure of PDB 4kny Chain A Binding Site BS01

Receptor Information

>4kny Chain A (length=222) Species: 83333 (Escherichia coli K-12)

AMANVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKPDLI
ILDLGLPDGDGIEFIRDLRQWSAVPVIVLSARSEESDKIAALDAGADDYL
SKPFGIGELQARLRVALRRHAPDPLVKFSDVTVDLAARVIHRGEEEVHLT
PIEFRLLAVLLNNAGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQKL
EQDPARPRHFITETGIGYRFML

Ligand information

>4kny Chain Y (length=24)

catttttatactttttttacaccc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4kny An asymmetric heterodomain interface stabilizes a response regulator-DNA complex.
• Resolution: 2.945 Å
• Binding residue (original residue number in PDB): H151 T153 I155 W181 Y191 I194 Y195
• Binding residue (residue number reindexed from 1): H148 T150 I152 W178 Y188 I191 Y192

Gene Ontology

Molecular Function

• GO:0000156 phosphorelay response regulator activity
• GO:0000976 transcription cis-regulatory region binding
• GO:0000987 cis-regulatory region sequence-specific DNA binding
• GO:0001216 DNA-binding transcription activator activity
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005515 protein binding
• GO:0042803 protein homodimerization activity

Biological Process

• GO:0000160 phosphorelay signal transduction system
• GO:0006355 regulation of DNA-templated transcription
• GO:0045893 positive regulation of DNA-templated transcription

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0032993 protein-DNA complex

External links

• PDB: RCSB:4kny, PDBe:4kny, PDBj:4kny
• PDBsum: 4kny
• PubMed: 24526190
• UniProt: P21866|KDPE_ECOLI KDP operon transcriptional regulatory protein KdpE (Gene Name=kdpE)