Structure of PDB 4knq Chain A Binding Site BS01

Receptor Information
>4knq Chain A (length=122) Species: 12145 (Tomato bushy stunt virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMTSPFKLPDESPSWTEWRLHNDETQDNPLGFKESWGFGKVVFKRYLRYD
RTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGS
RTLQHLCEMAIRSKQELLQLAP
Ligand information
>4knq Chain B (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccgccgccgccgccgccgcg
....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4knq Structural insights into CNG-repetitive RNAs associated with human Trinucleotide Repeat Expansion Diseases (TREDs)
Resolution1.82 Å
Binding residue
(original residue number in PDB)		P15 W17 W20 Q31 K38 Y51 Q85 I86 G87 R93 S102 G103 G104
Binding residue
(residue number reindexed from 1)		P13 W15 W18 Q26 K33 Y46 Q80 I81 G82 R88 S97 G98 G99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0044423 virion component

View graph for
Cellular Component
External links
PDB RCSB:4knq, PDBe:4knq, PDBj:4knq
PDBsum4knq
PubMed
UniProtP69517|P19_TBSVK RNA silencing suppressor p19 (Gene Name=ORF4)

[Back to BioLiP]