Structure of PDB 4kmf Chain A Binding Site BS01

Receptor Information

>4kmf Chain A (length=62) Species: 7957 (Carassius auratus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SAETQMERKIIDFLRQNGKSIALTIAKEIGLDKSTVNRHLYNLQRSNQVF
NSNEKPPVWDLM

Ligand information

>4kmf Chain B (length=7) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tcgcgcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4kmf Distinct Z-DNA binding mode of a PKR-like protein kinase containing a Z-DNA binding domain (PKZ).
Resolution	1.7 Å
Binding residue (original residue number in PDB)	S35 N38 R39 Y42 K56 P57 P58
Binding residue (residue number reindexed from 1)	S34 N37 R38 Y41 K55 P56 P57

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003726	double-stranded RNA adenosine deaminase activity

View graph for
Molecular Function

External links

PDB	RCSB:4kmf, PDBe:4kmf, PDBj:4kmf
PDBsum	4kmf
PubMed	24682817
UniProt	Q7T2M9

[Back to BioLiP]