Structure of PDB 4kji Chain A Binding Site BS01

Receptor Information
>4kji Chain A (length=64) Species: 208963 (Pseudomonas aeruginosa UCBPP-PA14) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FLILSRREGEGITLSLKADYPAEELIRQLREGGIRILVTDIIGNQARVGI
EAPRGVLIVRDELK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4kji Structural Rearrangement in an RsmA/CsrA Ortholog of Pseudomonas aeruginosa Creates a Dimeric RNA-Binding Protein, RsmN.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		F3 L4 I5 L6 S7 R9 T41 G45 R49 A54 R56 V58 L59 I60 V61 R62 L65
Binding residue
(residue number reindexed from 1)		F1 L2 I3 L4 S5 R7 T39 G43 R47 A52 R54 V56 L57 I58 V59 R60 L63
Binding affinityPDBbind-CN: Kd=276nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0042802 identical protein binding
Biological Process
GO:0006109 regulation of carbohydrate metabolic process
GO:0006402 mRNA catabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4kji, PDBe:4kji, PDBj:4kji
PDBsum4kji
PubMed23954502
UniProtA0A0H2ZIZ8

[Back to BioLiP]