Structure of PDB 4ki2 Chain A Binding Site BS01

Receptor Information
>4ki2 Chain A (length=178) Species: 271 (Thermus aquaticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELI
REVVRAKILGTARIQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHIA
REGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKF
EYKRRFKFSTYATWWIRQAINRAIADQA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ki2 Crystallographic analysis of an RNA polymerase sigma-subunit fragment complexed with -10 promoter element ssDNA: quadruplex formation as a possible tool for engineering crystal contacts in protein-ssDNA complexes.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		L108 N206 R208 L209 S212 K215 E243 R246 F248 K249 S251 T252 Y253 T255 W256 W257
Binding residue
(residue number reindexed from 1)		L16 N114 R116 L117 S120 K123 E151 R154 F156 K157 S159 T160 Y161 T163 W164 W165
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4ki2, PDBe:4ki2, PDBj:4ki2
PDBsum4ki2
PubMed23989139
UniProtQ9EZJ8|SIGA_THEAQ RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]