Structure of PDB 4kb0 Chain A Binding Site BS01

Receptor Information
>4kb0 Chain A (length=207) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDT
TLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKG
IKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAG
LALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGG
WPLSAAE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4kb0 Structural insights into DNA repair by RNase T--an exonuclease processing 3' end of structured DNA in repair pathways.
Resolution2.004 Å
Binding residue
(original residue number in PDB)
E25 T26 F29 E73 A74 F77 H120 N121 F124 V163
Binding residue
(residue number reindexed from 1)
E19 T20 F23 E67 A68 F71 H114 N115 F118 V157
Enzymatic activity
Enzyme Commision number 3.1.13.-
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0000287 magnesium ion binding
GO:0003676 nucleic acid binding
GO:0004527 exonuclease activity
GO:0004540 RNA nuclease activity
GO:0005515 protein binding
GO:0008310 single-stranded DNA 3'-5' DNA exonuclease activity
GO:0008408 3'-5' exonuclease activity
GO:0016896 RNA exonuclease activity, producing 5'-phosphomonoesters
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
Biological Process
GO:0006259 DNA metabolic process
GO:0006396 RNA processing
GO:0006974 DNA damage response
GO:0008033 tRNA processing
GO:0031125 rRNA 3'-end processing
GO:0034644 cellular response to UV
GO:0042780 tRNA 3'-end processing
GO:0043628 regulatory ncRNA 3'-end processing
GO:0045004 DNA replication proofreading
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4kb0, PDBe:4kb0, PDBj:4kb0
PDBsum4kb0
PubMed24594808
UniProtP30014|RNT_ECOLI Ribonuclease T (Gene Name=rnt)

[Back to BioLiP]