Structure of PDB 4ka4 Chain A Binding Site BS01

Receptor Information
>4ka4 Chain A (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLD
MDEQSKAWTIY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ka4 Crystal structure of a proteolytically defined Zbeta domain of human DAI (ZBP1, DLM-1)
Resolution2.6 Å
Binding residue
(original residue number in PDB)		K138 N141 R142 Y145
Binding residue
(residue number reindexed from 1)		K34 N37 R38 Y41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003726 double-stranded RNA adenosine deaminase activity
Biological Process
GO:0060340 positive regulation of type I interferon-mediated signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4ka4, PDBe:4ka4, PDBj:4ka4
PDBsum4ka4
PubMed
UniProtQ9H171|ZBP1_HUMAN Z-DNA-binding protein 1 (Gene Name=ZBP1)

[Back to BioLiP]