Structure of PDB 4k8b Chain A Binding Site BS01

Receptor Information
>4k8b Chain A (length=177) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVC
WTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSS
DLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVG
IFRAAVCTRGVAKAVDFVPVESMETTM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4k8b Ligand bioactive conformation plays a critical role in the design of drugs that target the hepatitis C virus NS3 protease.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		I3 T4 A5 Y6 S7 Q8 T10 R11 C16 T19 S20 E30 V33 Q34 V35 V36 S37 T63 L64 A65 V107 R109
Binding residue
(residue number reindexed from 1)		I1 T2 A3 Y4 S5 Q6 T8 R9 C14 T17 S18 E28 V31 Q32 V33 V34 S35 T61 L62 A63 V105 R107
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D81 G137 S139
Catalytic site (residue number reindexed from 1) H55 D79 G135 S137
Enzyme Commision number 3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0008233 peptidase activity
GO:0008236 serine-type peptidase activity
GO:0046872 metal ion binding
Biological Process
GO:0006508 proteolysis
GO:0019062 virion attachment to host cell
GO:0019087 transformation of host cell by virus
GO:0046718 symbiont entry into host cell
Cellular Component
GO:0016020 membrane
GO:0033644 host cell membrane
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4k8b, PDBe:4k8b, PDBj:4k8b
PDBsum4k8b
PubMed24144444
UniProtQ0ZNA6

[Back to BioLiP]