Structure of PDB 4jzu Chain A Binding Site BS01

Receptor Information
>4jzu Chain A (length=157) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYEFKDYYQNTVQLSFDDQPFSDSPKHVWVICRFGGKWLLTEHEDRGYEF
PGGKVEPMECAEEAALREVKEETGARVKSLKYLGQYKVLGKEKVIVKNIY
FADIEKLEKQADYFETKGPVLFHELPENLSRNKKFSFIMKDSVLPISLKK
LKESGWI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jzu Bacillus subtilis RNA deprotection enzyme RppH recognizes guanosine in the second position of its substrates.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		D6 K54 Y86 V88 K93 I95 K97 F137 I138
Binding residue
(residue number reindexed from 1)		D6 K54 Y86 V88 K93 I95 K97 F137 I138
Enzymatic activity
Enzyme Commision number 3.6.1.55: 8-oxo-dGTP diphosphatase.
Gene Ontology
Molecular Function
GO:0016787 hydrolase activity
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0035539 8-oxo-7,8-dihydrodeoxyguanosine triphosphate pyrophosphatase activity
GO:0046872 metal ion binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4jzu, PDBe:4jzu, PDBj:4jzu
PDBsum4jzu
PubMed23610407
UniProtO35013|YTKD_BACSU Putative 8-oxo-dGTP diphosphatase YtkD (Gene Name=ytkD)

[Back to BioLiP]