Structure of PDB 4jzo Chain A Binding Site BS01

Receptor Information
>4jzo Chain A (length=215) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVTLKESGAEVKKPGSSVKVSCEASGGTLSNYVITWVRQAPGQGLEWMGG
FIPTFRTAMYAQGFQGRVTITADESTSIAYMELTNLRSEDTAVYYCARGP
LSRGYYDYWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPE
PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV
NHKPSNTKVDKKAEP
Ligand information
>4jzo Chain J (length=11) Species: 11108 (Hepatitis C virus (isolate H)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GWLAGLFYQHK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jzo Structural basis of HCV neutralization by human monoclonal antibodies resistant to viral neutralization escape.
Resolution2.22 Å
Binding residue
(original residue number in PDB)		V33 G50 I52 F55 M59 S102 G104
Binding residue
(residue number reindexed from 1)		V33 G50 I52 F55 M59 S102 G104
External links