Structure of PDB 4jyi Chain A Binding Site BS01

Receptor Information
>4jyi Chain A (length=239) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWD
KFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTR
YTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTET
GLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPK
ILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMME
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jyi An Unexpected Mode Of Binding Defines BMS948 as A Full Retinoic Acid Receptor beta (RAR beta , NR1B2) Selective Agonist.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		K237 Q250 I251 P401 L402 Q404 E405
Binding residue
(residue number reindexed from 1)		K68 Q81 I82 P232 L233 Q235 E236
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0048384 retinoic acid receptor signaling pathway
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4jyi, PDBe:4jyi, PDBj:4jyi
PDBsum4jyi
PubMed25933005
UniProtP10826|RARB_HUMAN Retinoic acid receptor beta (Gene Name=RARB)

[Back to BioLiP]