Structure of PDB 4jyh Chain A Binding Site BS01

Receptor Information
>4jyh Chain A (length=239) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWD
KFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTR
YTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTET
GLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPK
ILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMME
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jyh An Unexpected Mode Of Binding Defines BMS948 as A Full Retinoic Acid Receptor beta (RAR beta , NR1B2) Selective Agonist.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		K237 I251 Q404 E405 M406
Binding residue
(residue number reindexed from 1)		K68 I82 Q235 E236 M237
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0048384 retinoic acid receptor signaling pathway
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4jyh, PDBe:4jyh, PDBj:4jyh
PDBsum4jyh
PubMed25933005
UniProtP10826|RARB_HUMAN Retinoic acid receptor beta (Gene Name=RARB)

[Back to BioLiP]