Structure of PDB 4jxt Chain A Binding Site BS01

Receptor Information
>4jxt Chain A (length=130) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKA
KPNRKLTFLYLANDVIQNSKRKGPEFTKDFAPVIVEAFKHVSSETDESCK
KHLGRVLSIWEERSVYENDVLEQLKQALYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jxt RPRD1A and RPRD1B are human RNA polymerase II C-terminal domain scaffolds for Ser5 dephosphorylation.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		N18 S19 Q20 V23 Y61 N64 D65 Q68 I110 R114 G131
Binding residue
(residue number reindexed from 1)		N17 S18 Q19 V22 Y60 N63 D64 Q67 I109 R113 G130
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0099122 RNA polymerase II C-terminal domain binding

View graph for
Molecular Function
External links
PDB RCSB:4jxt, PDBe:4jxt, PDBj:4jxt
PDBsum4jxt
PubMed24997600
UniProtQ96P16|RPR1A_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1A (Gene Name=RPRD1A)

[Back to BioLiP]