Structure of PDB 4jwe Chain A Binding Site BS01

Receptor Information

>4jwe Chain A (length=213) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTI
HVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSA
KDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQ
GDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKM
QELAQVSQKLMEI

Ligand information

>4jwe Chain C (length=9) Species: 9940 (Ovis aries) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RPRLPRPRP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4jwe Structural Identification of DnaK Binding Sites within Bovine and Sheep Bactenecin Bac7.
Resolution	1.95 Å
Binding residue (original residue number in PDB)	D518 A521 N522
Binding residue (residue number reindexed from 1)	D130 A133 N134

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005524	ATP binding
GO:0140662	ATP-dependent protein folding chaperone

View graph for
Molecular Function

External links

PDB	RCSB:4jwe, PDBe:4jwe, PDBj:4jwe
PDBsum	4jwe
PubMed	24164259
UniProt	P0A6Y8\|DNAK_ECOLI Chaperone protein DnaK (Gene Name=dnaK)

[Back to BioLiP]