Structure of PDB 4jvy Chain A Binding Site BS01

Receptor Information
>4jvy Chain A (length=191) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHEATVEYLADLVKEKKHLTLFPHMFSNVERLLDDEIGRVRVALFQTEFP
RVELPEPAGDMISITEKIYVPKNEYPDYNFVGRILGPRGMTAKQLEQDTG
CKIMVRGKGSMRDKSKESAHRGKANWEHLEDDLHVLVQCEDTENRVHIKL
QAALEQVKKLLIPAPEGTDELKRKQLMELAIINGTYRPMKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jvy Structure-function studies of STAR family Quaking proteins bound to their in vivo RNA target sites.
Resolution2.853 Å
Binding residue
(original residue number in PDB)		N220 V222 G223 R224 L226 G227 P228 R229 G230 K234 K243 M245 V246 R247 R253 K313 Q316 L317 L320
Binding residue
(residue number reindexed from 1)		N79 V81 G82 R83 L85 G86 P87 R88 G89 K93 K102 M104 V105 R106 R112 K172 Q175 L176 L179
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4jvy, PDBe:4jvy, PDBj:4jvy
PDBsum4jvy
PubMed23630077
UniProtQ17339|GLD1_CAEEL Female germline-specific tumor suppressor gld-1 (Gene Name=gld-1)

[Back to BioLiP]