Structure of PDB 4jvh Chain A Binding Site BS01

Receptor Information
>4jvh Chain A (length=176) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPTPDYLMQLMNDKKLMSNHLERLLDEEISRVRKDMYNDTSAELPDAVGP
IVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGS
MRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKL
LVPAAEGEDSLKKMQLMELAILNGTY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jvh Structure-function studies of STAR family Quaking proteins bound to their in vivo RNA target sites.
Resolution3.501 Å
Binding residue
(original residue number in PDB)		G100 R101 L103 G104 P105 R106 G107 K111 K120 M122 V123 R124 R130 K190 L194 L197 A198 Y204
Binding residue
(residue number reindexed from 1)		G72 R73 L75 G76 P77 R78 G79 K83 K92 M94 V95 R96 R102 K162 L166 L169 A170 Y176
Binding affinityPDBbind-CN: Kd=0.07uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4jvh, PDBe:4jvh, PDBj:4jvh
PDBsum4jvh
PubMed23630077
UniProtQ96PU8|QKI_HUMAN KH domain-containing RNA-binding protein QKI (Gene Name=QKI)

[Back to BioLiP]