Structure of PDB 4jr2 Chain A Binding Site BS01

Receptor Information
>4jr2 Chain A (length=224) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLG
FDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDG
VTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGKIPVEADFLFAYSTVPG
YYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSD
DPHFHEKKQIPCVVSMLTKELYFS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jr2 Structural snapshots reveal distinct mechanisms of procaspase-3 and -7 activation.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		R87 S143 H144 Q184 C186 Y230 S231 W232 R233 P235 S275 Q276
Binding residue
(residue number reindexed from 1)		R32 S88 H89 Q129 C131 Y152 S153 W154 R155 P157 S197 Q198
Enzymatic activity
Catalytic site (original residue number in PDB) G85 V86 H144 G145 C186
Catalytic site (residue number reindexed from 1) G30 V31 H89 G90 C131
Enzyme Commision number 3.4.22.60: caspase-7.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4jr2, PDBe:4jr2, PDBj:4jr2
PDBsum4jr2
PubMed23650375
UniProtP55210|CASP7_HUMAN Caspase-7 (Gene Name=CASP7)

[Back to BioLiP]