Structure of PDB 4jr1 Chain A Binding Site BS01

Receptor Information
>4jr1 Chain A (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLG
FDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDG
VTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTINDTDANPRYKIPVEA
DFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVND
RVARHFKQIPCVVSMLTKELYFS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jr1 Structural snapshots reveal distinct mechanisms of procaspase-3 and -7 activation.
Resolution2.149 Å
Binding residue
(original residue number in PDB)		R87 H144 C186 Y230 S231 W232 R233 S234 P235
Binding residue
(residue number reindexed from 1)		R32 H89 C131 Y163 S164 W165 R166 S167 P168
Enzymatic activity
Catalytic site (original residue number in PDB) G85 V86 H144 G145 C186
Catalytic site (residue number reindexed from 1) G30 V31 H89 G90 C131
Enzyme Commision number 3.4.22.60: caspase-7.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4jr1, PDBe:4jr1, PDBj:4jr1
PDBsum4jr1
PubMed23650375
UniProtP55210|CASP7_HUMAN Caspase-7 (Gene Name=CASP7)

[Back to BioLiP]